Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
Color wheel
Recolor
detailed
Detailed
compact
Compact
pulsar line style android tablet icon
Android Tablet
pulsar line style wacom tablet icon
Wacom Tablet
pulsar line style windows8 tablet icon
Windows8 Tablet
pulsar line style ipad icon
iPad
pulsar line style smartphones icon
Smartphones
pulsar line style ipad mini icon
iPad Mini
pulsar line style smartphone tablet icon
Smartphone Tablet
pulsar line style multiple devices icon
Multiple Devices
pulsar line style tilt icon
Tilt
pulsar line style kindle icon
Kindle
pulsar line style nook icon
Nook
pulsar line style read online icon
Read Online
pulsar line style device shop icon
Device Shop
pulsar line style device manager icon
Device Manager
pulsar line style portable speaker icon
Portable Speaker
pulsar line style device information icon
Device Information
pulsar line style electronic cigarette icon
Electronic Cigarette
pulsar line style pump icon
Pump
pulsar line style my computer icon
My Computer
pulsar line style mobile charger icon
Mobile Charger
pulsar line style game controller icon
Game Controller
pulsar line style softbox icon
Softbox
pulsar line style mobile id verification icon
Mobile Id Verification
pulsar line style smartphone approved icon
Smartphone Approved
pulsar line style laser beam icon
Laser Beam
pulsar line style fingerprint recognition icon
Fingerprint Recognition
pulsar line style augmented reality icon
Augmented Reality
pulsar line style seat heater icon
Seat Heater
pulsar line style catalytic converter warning icon
Catalytic Converter Warning
pulsar line style rain sensor icon
Rain Sensor
pulsar line style pacemaker icon
Pacemaker
pulsar line style blockchain node icon
Blockchain Node
pulsar line style charging low battery icon
Charging Low Battery
pulsar line style sensor icon
Sensor
pulsar line style vacuum cleaner icon
Vacuum Cleaner
pulsar line style apple tv icon
Apple TV
pulsar line style touchscreen icon
Touchscreen
pulsar line style barcode reader icon
Barcode Reader
pulsar line style guitar amp icon
Guitar Amp
pulsar line style virtual reality icon
Virtual Reality
pulsar line style featurephone icon
Featurephone
pulsar line style charging battery icon
Charging Battery
pulsar line style slr icon
SLR
pulsar line style nearly empty battery icon
Nearly Empty Battery
pulsar line style laptop password icon
Laptop Password
pulsar line style airpods pro icon
AirPods Pro
pulsar line style dehumidifier icon
Dehumidifier
pulsar line style spirometer icon
Spirometer
pulsar line style robot vacuum cleaner icon
Robot Vacuum Cleaner
pulsar line style tonometer icon
Tonometer
pulsar line style ph meter icon
Ph Meter
pulsar line style swipe heart right icon
Swipe Heart Right
pulsar line style augmented reality icon
Augmented Reality
pulsar line style phonelink lock icon
Phonelink Lock
pulsar line style ereader icon
Ereader
pulsar line style land mine icon
Land Mine
pulsar line style phonelink ring icon
Phonelink Ring
pulsar line style thin client icon
Thin Client
pulsar line style camera on tripod icon
Camera on Tripod
pulsar line style sidebar menu icon
Sidebar Menu
Remove ad

Download 192 free Tablet device Icons in design styles.

Get free icons of Tablet device in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

wwwteamspeakcalanderdevicetechnologygadgetdigitalmobileelectronicphone