Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
#a1785c
detailed
Detailed
compact
Compact
dna message icon
DNA Message
dna presentation icon
DNA Presentation
dna analysis icon
DNA Analysis
dna smartphone icon
DNA Smartphone
dna idea icon
DNA Idea
dna mobile icon
DNA Mobile
dna test icon
Dna Test
dna research icon
DNA Research
dna settings icon
DNA Settings
dna clipboard icon
DNA Clipboard
dna structure icon
DNA Structure
dna sequencing icon
DNA Sequencing
dna schedule icon
DNA Schedule
dna folder icon
DNA Folder
dna analysis icon
DNA Analysis
dna report icon
DNA Report
dna book icon
DNA Book
targeting dna icon
Targeting DNA
dna structure icon
DNA Structure
dna sequence protection icon
DNA Sequence Protection
dna report icon
DNA Report
targeting dna icon
Targeting DNA
targeting dna icon
Targeting DNA
dna desktop icon
DNA Desktop
dna share icon
DNA Share
dna recycle icon
DNA Recycle
dna share icon
DNA Share
processing dna icon
Processing DNA
dna research website icon
DNA Research Website
dna mail icon
DNA Mail
genetic engineering icon
Genetic Engineering
dna recycle icon
DNA Recycle
dna computer icon
DNA Computer
dna screening presentation icon
DNA Screening Presentation
mouse dna icon
Mouse DNA
online dna icon
Online DNA
online dna icon
Online DNA
dna icon
DNA
online dna icon
Online DNA
dna icon
DNA
dna icon
DNA
dna icon
DNA
online dna icon
Online DNA
dna icon
DNA
infected dna icon
Infected DNA
dna icon
DNA
chromosome string icon
Chromosome String
dna icon
DNA
genetic engineering icon
Genetic Engineering
genetic engineering icon
Genetic Engineering
dna strand icon
DNA Strand
dna strand icon
DNA Strand
dna strand icon
DNA Strand
Remove ad

Download 53 free Strand Icons in design styles.

Get free icons of Strand in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

free licensegoogle paymeditateswiftmayaminimalsamsung logoscience