Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
#ffb600
detailed
Detailed
compact
Compact
liquid glass style sigma icon
liquid glass style beta icon
liquid glass style epsilon icon
liquid glass style flipboard icon
liquid glass style communication icon
liquid glass style certificate icon
liquid glass style statistics icon
liquid glass style critical thinking icon
Liquid Glass
3,274 icons
Liquid Glass Color
111 icons
ios 17 outlined style test tube icon
ios 17 outlined style benzene ring icon
ios 17 outlined style biotech icon
ios 17 outlined style bacteria icon
ios 17 outlined style trigonometry icon
ios 17 outlined style comparator icon
ios 17 outlined style learning icon
ios 17 outlined style abscissa icon
iOS 17 Outlined
11,111 icons
ios 17 filled style test tube icon
ios 17 filled style benzene ring icon
ios 17 filled style biotech icon
ios 17 filled style bacteria icon
ios 17 filled style trigonometry icon
ios 17 filled style comparator icon
ios 17 filled style learning icon
ios 17 filled style abscissa icon
iOS 17 Filled
10,593 icons
color style test tube icon
color style benzene ring icon
color style biotech icon
color style bacteria icon
color style trigonometry icon
color style comparator icon
color style learning icon
color style abscissa icon
Color
12,926 icons
windows 11 color style test tube icon
windows 11 color style benzene ring icon
windows 11 color style biotech icon
windows 11 color style bacteria icon
windows 11 color style trigonometry icon
windows 11 color style comparator icon
windows 11 color style learning icon
windows 11 color style abscissa icon
Windows 11 Color
7,771 icons
ios 17 glyph style test tube icon
ios 17 glyph style benzene ring icon
ios 17 glyph style biotech icon
ios 17 glyph style bacteria icon
ios 17 glyph style trigonometry icon
ios 17 glyph style comparator icon
ios 17 glyph style learning icon
ios 17 glyph style abscissa icon
iOS 17 Glyph
8,222 icons
windows 10 style test tube icon
windows 10 style biotech icon
windows 10 style bacteria icon
windows 10 style trigonometry icon
windows 10 style graduation cap icon
windows 10 style literature icon
windows 10 style physics icon
windows 10 style peptide icon
Windows 10
9,189 icons
material outlined style test tube icon
material outlined style biotech icon
material outlined style graduation cap icon
material outlined style literature icon
material outlined style physics icon
material outlined style peptide icon
material outlined style scales icon
material outlined style artificial intelligence icon
Material Outlined
5,569 icons
3d fluency style minus math icon
3d fluency style book icon
3d fluency style open book icon
3d fluency style library icon
3d fluency style calculator icon
3d fluency style microscope icon
3d fluency style tonometer icon
3d fluency style law icon
3D Fluency
1,980 icons
dotted style test tube icon
dotted style benzene ring icon
dotted style biotech icon
dotted style bacteria icon
dotted style trigonometry icon
dotted style comparator icon
dotted style learning icon
dotted style abscissa icon
Dotted
5,968 icons
gradient style test tube icon
gradient style benzene ring icon
gradient style biotech icon
gradient style bacteria icon
gradient style trigonometry icon
gradient style comparator icon
gradient style learning icon
gradient style abscissa icon
Gradient
4,265 icons
material rounded style test tube icon
material rounded style biotech icon
material rounded style graduation cap icon
material rounded style literature icon
material rounded style physics icon
material rounded style peptide icon
material rounded style scales icon
material rounded style artificial intelligence icon
Material Rounded
5,503 icons
windows 11 outline style test tube icon
windows 11 outline style benzene ring icon
windows 11 outline style biotech icon
windows 11 outline style bacteria icon
windows 11 outline style trigonometry icon
windows 11 outline style comparator icon
windows 11 outline style learning icon
windows 11 outline style abscissa icon
Windows 11 Outline
9,168 icons
glyph neue style test tube icon
glyph neue style benzene ring icon
glyph neue style biotech icon
glyph neue style bacteria icon
glyph neue style trigonometry icon
glyph neue style comparator icon
glyph neue style learning icon
glyph neue style abscissa icon
Glyph Neue
4,031 icons
cute color style test tube icon
cute color style benzene ring icon
cute color style biotech icon
cute color style bacteria icon
cute color style trigonometry icon
cute color style comparator icon
cute color style learning icon
cute color style abscissa icon
Cute Color
4,132 icons
pastel glyph style minus icon
pastel glyph style books icon
pastel glyph style physics book icon
pastel glyph style book stack icon
pastel glyph style books 1 icon
pastel glyph style certificate icon
pastel glyph style diploma icon
pastel glyph style student male  v2 icon
Pastel Glyph
3,621 icons
material filled style test tube icon
material filled style biotech icon
material filled style graduation cap icon
material filled style literature icon
material filled style physics icon
material filled style peptide icon
material filled style scales icon
material filled style artificial intelligence icon
Material Filled
7,822 icons
windows 11 filled style test tube icon
windows 11 filled style benzene ring icon
windows 11 filled style biotech icon
windows 11 filled style bacteria icon
windows 11 filled style trigonometry icon
windows 11 filled style comparator icon
windows 11 filled style learning icon
windows 11 filled style abscissa icon
Windows 11 Filled
8,760 icons
color hand drawn style test tube icon
color hand drawn style benzene ring icon
color hand drawn style biotech icon
color hand drawn style bacteria icon
color hand drawn style trigonometry icon
color hand drawn style comparator icon
color hand drawn style learning icon
color hand drawn style abscissa icon
Color Hand Drawn
3,809 icons
cute outline style test tube icon
cute outline style benzene ring icon
cute outline style biotech icon
cute outline style bacteria icon
cute outline style trigonometry icon
cute outline style comparator icon
cute outline style learning icon
cute outline style abscissa icon
Cute Outline
3,933 icons
office m style test tube icon
office m style benzene ring icon
office m style biotech icon
office m style bacteria icon
office m style trigonometry icon
office m style comparator icon
office m style learning icon
office m style abscissa icon
Office M
4,804 icons
stickers style test tube icon
stickers style benzene ring icon
stickers style biotech icon
stickers style bacteria icon
stickers style trigonometry icon
stickers style comparator icon
stickers style learning icon
stickers style abscissa icon
Stickers
6,397 icons
outline hand drawn style test tube icon
outline hand drawn style benzene ring icon
outline hand drawn style biotech icon
outline hand drawn style bacteria icon
outline hand drawn style trigonometry icon
outline hand drawn style comparator icon
outline hand drawn style learning icon
outline hand drawn style abscissa icon
Outline Hand Drawn
3,792 icons
Remove ad

Download 7348 free Science Icons in design styles.

Get free icons of Science in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

front deskdata sciencewhite arrowraceteamspeakspidermanglypheducation