Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
#b5121b
detailed
Detailed
compact
Compact
windows 11 outline style name icon
Name
windows 11 outline style gender icon
Gender
windows 11 outline style male icon
Male
windows 11 outline style name tag icon
Name Tag
windows 11 outline style name tag woman horizontal icon
Name Tag Woman Horizontal
windows 11 outline style gender equality icon
Gender Equality
windows 11 outline style gender neutral washroom icon
Gender Neutral Washroom
windows 11 outline style domain name icon
Domain Name
windows 11 outline style mars symbol icon
Mars Symbol
windows 11 outline style badge icon
Badge
windows 11 outline style name tag woman icon
Name Tag Woman
windows 11 outline style rename icon
Rename
windows 11 outline style user icon
User
Animated badge
windows 11 outline style user icon
User
windows 11 outline style venus symbol icon
Venus Symbol
windows 11 outline style male and female icon
Male and Female
windows 11 outline style male stroke v icon
Male Stroke V
windows 11 outline style androgyne icon
Androgyne
windows 11 outline style male stroke h icon
Male Stroke H
windows 11 outline style triceps icon
Triceps
windows 11 outline style mens underwear icon
Mens Underwear
windows 11 outline style cartoon boy icon
Cartoon Boy
windows 11 outline style female icon
Female
windows 11 outline style whois icon
Whois
windows 11 outline style add user icon
Add User
windows 11 outline style find user male icon
Find User Male
windows 11 outline style checked identification documents icon
Checked Identification Documents
windows 11 outline style autograph icon
Autograph
windows 11 outline style dog tag icon
Dog Tag
windows 11 outline style dog tag icon
Dog Tag
windows 11 outline style id verified icon
ID Verified
windows 11 outline style same sex marriage icon
Same Sex Marriage
windows 11 outline style woman icon
Woman
windows 11 outline style customer icon
Customer
windows 11 outline style male user icon
Male User
windows 11 outline style un women icon
Un Women
windows 11 outline style agender symbol icon
Agender Symbol
windows 11 outline style transgender icon
Transgender
windows 11 outline style neuter icon
Neuter
windows 11 outline style boy icon
Boy
windows 11 outline style unisex icon
Unisex
windows 11 outline style username icon
Username
windows 11 outline style select name icon
Select Name
windows 11 outline style select name icon
Select Name
windows 11 outline style toilet icon
Toilet
windows 11 outline style collaborator icon
Collaborator
windows 11 outline style collaborator male icon
Collaborator Male
windows 11 outline style contact details icon
Contact Details
windows 11 outline style identification documents icon
Identification Documents
windows 11 outline style unfpa icon
UNFPA
windows 11 outline style homosexual icon
Homosexual
Remove ad

Download 51 free Gender masculine name Icons in design styles.

Get free icons of Gender masculine name in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

dark modebutterflycricketgenderfemalemalewomannamemasculineshapes and symbols