Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
#0ff48c
detailed
Detailed
compact
Compact
pulsar line style car theft icon
Car Theft
pulsar line style car icon
Car
pulsar line style identity theft icon
Identity Theft
pulsar line style car rental icon
Car Rental
pulsar line style toy car icon
Toy Car
pulsar line style car service icon
Car Service
pulsar line style automatic car wash icon
Automatic Car Wash
pulsar line style car charger icon
Car Charger
pulsar line style car fire icon
Car Fire
pulsar line style garage icon
Garage
pulsar line style f1 car icon
F1 Car
pulsar line style taxi icon
Taxi
pulsar line style car sharing icon
Car Sharing
pulsar line style car badge icon
Car Badge
pulsar line style car sale icon
Car Sale
pulsar line style car cleaning icon
Car Cleaning
pulsar line style police car icon
Police Car
pulsar line style car racing icon
Car Racing
pulsar line style railcar icon
Railcar
pulsar line style carpool icon
Carpool
pulsar line style autonomous vehicles icon
Autonomous Vehicles
pulsar line style electric vehicle icon
Electric Vehicle
pulsar line style sedan icon
Sedan
pulsar line style car roof box icon
Car Roof Box
pulsar line style automotive icon
Automotive
pulsar line style limousine icon
Limousine
pulsar line style bumper car icon
Bumper Car
pulsar line style cable car icon
Cable Car
pulsar line style car battery icon
Car Battery
pulsar line style boot open icon
Boot Open
pulsar line style traction control icon
Traction Control
pulsar line style burglary icon
Burglary
pulsar line style olympic torch icon
Olympic Torch
pulsar line style robber icon
Robber
pulsar line style black ski mask icon
Black Ski Mask
pulsar line style hill descent control icon
Hill Descent Control
pulsar line style people in car icon
People in Car
pulsar line style seat heater icon
Seat Heater
pulsar line style fuel filter warning icon
Fuel Filter Warning
pulsar line style lease icon
Lease
pulsar line style driving guidelines icon
Driving Guidelines
pulsar line style car top view icon
Car Top View
pulsar line style catalytic converter warning icon
Catalytic Converter Warning
pulsar line style key not in vehicle icon
Key Not in Vehicle
pulsar line style automatic gearbox warning icon
Automatic Gearbox Warning
pulsar line style gear stick icon
Gear Stick
pulsar line style air recirculation icon
Air Recirculation
pulsar line style air recirculation icon
Air Recirculation
pulsar line style headlight icon
Headlight
pulsar line style door lock icon
Door Lock
pulsar line style abs icon
ABS
pulsar line style engine oil icon
Engine Oil
pulsar line style service reminder indicator icon
Service Reminder Indicator
pulsar line style brake warning icon
Brake Warning
pulsar line style taxi rank icon
Taxi Rank
pulsar line style cab icon
Cab
pulsar line style taxi mobile app icon
Taxi Mobile App
pulsar line style taxi mobile payment icon
Taxi Mobile Payment
pulsar line style oil tanker icon
Oil Tanker
pulsar line style parking and 2nd floor icon
Parking and 2nd Floor
Remove ad

Download 94 free Car theft Icons in design styles.

Get free icons of Car theft in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

password eyeteamspeakcsvcarvehicletransportationtransportautomobileautoautomotive