Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
Color wheel
Recolor
detailed
Detailed
compact
Compact
Accident
material rounded style car fire icon
Car Fire
material rounded style flood car icon
Flood Car
material rounded style hail damage icon
Hail Damage
material rounded style shipwreck icon
Shipwreck
Aircraft
material rounded style aerodynamic icon
Aerodynamic
material rounded style air traffic control tower icon
Air Traffic Control Tower
material rounded style aircraft icon
Aircraft
material rounded style aircraft galley icon
Aircraft Galley
material rounded style aircraft seat aisle icon
Aircraft Seat Aisle
material rounded style aircraft seat middle icon
Aircraft Seat Middle
material rounded style aircraft seat window icon
Aircraft Seat Window
material rounded style airplane icon
Airplane
material rounded style airplane landing icon
Airplane Landing
material rounded style airplane mode off icon
Airplane Mode Off
material rounded style airplane tail fin icon
Airplane Tail Fin
material rounded style airplane take off icon
Airplane Take Off
material rounded style airplane window closed icon
Airplane Window Closed
material rounded style airplane window open icon
Airplane Window Open
material rounded style airport icon
Airport
material rounded style dirigible icon
Dirigible
material rounded style drone icon
Drone
material rounded style drone bottom view icon
Drone Bottom View
material rounded style flight seat icon
Flight Seat
material rounded style helicopter icon
Helicopter
material rounded style hot air balloon icon
Hot Air Balloon
material rounded style jet engine icon
Jet Engine
material rounded style jet engine transportation cradle icon
Jet Engine Transportation Cradle
material rounded style jetpack icon
Jetpack
material rounded style launch icon
Launch
material rounded style plane icon
Plane
material rounded style quadcopter icon
Quadcopter
material rounded style rocket icon
Rocket
material rounded style runway icon
Runway
material rounded style scissor lift icon
Scissor Lift
material rounded style space shuttle icon
Space Shuttle
material rounded style tandem rotor icon
Tandem Rotor
material rounded style turbine aircraft icon
Turbine Aircraft
Remove ad
All-terrain vehicle
material rounded style atv icon
ATV
material rounded style quad bike icon
Quad Bike
material rounded style snowmobile icon
Snowmobile
material rounded style utv icon
UTV
Bikes
material rounded style bicycle icon
Bicycle
material rounded style bike trainer icon
Bike Trainer
material rounded style cyclist top view icon
Cyclist Top View
material rounded style mobility scooter icon
Mobility Scooter
material rounded style motocross helmet icon
Motocross Helmet
material rounded style motorbike helmet icon
Motorbike Helmet
material rounded style motorcycle icon
Motorcycle
material rounded style protected bike lane icon
Protected Bike Lane
material rounded style scooter icon
Scooter
material rounded style taxi tricycle icon
Taxi Tricycle
material rounded style tricycle icon
Tricycle
material rounded style unicycle icon
Unicycle
Car dashboard symbols
material rounded style abs icon
ABS
material rounded style air recirculation icon
Air Recirculation
material rounded style air suspension warning icon
Air Suspension Warning
material rounded style airbag icon
Airbag
material rounded style automatic gearbox warning icon
Automatic Gearbox Warning
material rounded style boot open icon
Boot Open
material rounded style brake pad warning icon
Brake Pad Warning
material rounded style brake warning icon
Brake Warning
material rounded style car service icon
Car Service
material rounded style car warning icon
Car Warning
material rounded style catalytic converter warning icon
Catalytic Converter Warning
material rounded style convertible roof warning icon
Convertible Roof Warning
material rounded style cruise control on icon
Cruise Control On
material rounded style distance warning icon
Distance Warning
material rounded style door ajar icon
Door Ajar
material rounded style door lock icon
Door Lock
material rounded style driving icon
Driving
material rounded style eco driving indicator icon
Eco Driving Indicator
material rounded style engine coolant icon
Engine Coolant
material rounded style engine oil icon
Engine Oil
material rounded style fan speed icon
Fan Speed
material rounded style fog lamp icon
Fog Lamp
material rounded style foot outlet icon
Foot Outlet
material rounded style fresh air icon
Fresh Air
material rounded style frost warning icon
Frost Warning
material rounded style fuel filter warning icon
Fuel Filter Warning
material rounded style gearbox icon
Gearbox
material rounded style glow plug icon
Glow Plug
material rounded style hazard warning flasher icon
Hazard Warning Flasher
material rounded style headlight icon
Headlight
material rounded style hill descent control icon
Hill Descent Control
material rounded style horn icon
Horn
material rounded style ignition switch warning icon
Ignition Switch Warning
material rounded style illumination brightness icon
Illumination Brightness
material rounded style key fob battery low icon
Key Fob Battery Low
material rounded style key not in vehicle icon
Key Not in Vehicle
material rounded style panel outlet icon
Panel Outlet
material rounded style panel and foot outlet icon
Panel and Foot Outlet
material rounded style parking assist icon
Parking Assist
material rounded style press break pedal icon
Press Break Pedal
material rounded style press clutch pedal icon
Press Clutch Pedal
material rounded style rain sensor icon
Rain Sensor
material rounded style rain and light sensor icon
Rain and Light Sensor
material rounded style rear window defogger icon
Rear Window Defogger
material rounded style roadside assistance icon
Roadside Assistance
material rounded style safe distance icon
Safe Distance
material rounded style seat heater icon
Seat Heater
magnifier
Missing an icon? We will create it
Tell us about an icon you need, and we will draw it for free in one of the existing Icons8 styles.

Download free Transport Icons in design styles.

Get free icons of Transport in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

saludthis pctimelinetempleglyphswiftharry pottertransportation