Icons8 logo
  • Trend Popular Popular
    Free
Business
  • Trend Business Business
  • Trend Ecommerce Ecommerce
  • Trend Finance Finance
Entertainment
  • Trend Food Food
  • Trend Music Music
  • Trend Photo and Video Photo and Video
  • Trend Gaming Gaming
  • Trend Shopping Shopping
Nature
  • Trend Animals Animals
  • Trend Weather Weather
Office and work
  • Trend Editing Editing
  • Trend Files Files
  • Trend Folders Folders
  • Trend Messaging Messaging
  • Trend Printing Printing
  • Trend Social Media Social Media
People
  • Trend Characters Characters
  • Trend Hands Hands
  • Trend Household Household
  • Trend People People
  • Trend Profile Profile
  • Trend Healthcare Healthcare
Symbols
  • Trend Alphabet Alphabet
  • Trend Arrows Arrows
  • Trend Emoji Emoji
  • Trend Logos Logos
  • Trend Time And Date Time And Date
slideArrow
Hide sidebar hotKeyS
IconsIcons
Figma plugin
Windows app
Mac app
Style packs New icons MCP Forum Pricing
More
Products
Change lang
IconsMac and Windows appsPluginsIconizerAnimated IconsLine AwesomeEmoji iconsWindows 11 Color iconsGlyph NeueiOS Glyph iconsOuch!Mega CreatorAnimated IlllustrationsIllustration GeneratorMac and Windows appsPluginsAll styles3D illustrationsTrendy illustrationsEducation illustrationsBusiness illustrationsThreedioGenYOUHuman GeneratorFace GeneratorIllustration GeneratorFace SwapperSmart UpscalerGenerated facesGenerated full-length humansAI AnonymizerBackground RemoverDatasetsGenerated Photos APISmart Upscaler APIBackground Remover APIMooseMac and Windows appsPluginsFace SwapperSmart UpscalerBackground RemoverHuman GeneratorFace GeneratorAI-generated photosAI AnonymizerTransparent PNGMega CreatorMusicLunacyBlogForumPricing
English简体中文FrançaisDeutschItaliano日本語PortuguêsРусскийEspañol한국어
Icons
Icons
Icons Icons
Illustrations Illustrations
3D Models 3D Models
Photos Photos
Music Music

Filters
detailed
Detailed
compact
Compact
material two tone style sunken car icon
sunken car
material two tone style car icon
Car
material two tone style toy car icon
Toy Car
material two tone style car service icon
Car Service
material two tone style car fire icon
Car Fire
material two tone style convertible roof warning icon
Convertible Roof Warning
material two tone style garage icon
Garage
material two tone style f1 car icon
F1 Car
material two tone style race car icon
Race Car
material two tone style taxi icon
Taxi
material two tone style car door icon
Car Door
material two tone style car badge icon
Car Badge
material two tone style police car icon
Police Car
material two tone style car racing icon
Car Racing
material two tone style railcar icon
Railcar
material two tone style carpool icon
Carpool
material two tone style volkswagen icon
Volkswagen
material two tone style car insurance icon
Car Insurance
material two tone style electric vehicle icon
Electric Vehicle
material two tone style electromobile icon
Electromobile
material two tone style sedan icon
Sedan
material two tone style pickup front view icon
Pickup Front View
material two tone style car roof box icon
Car Roof Box
material two tone style booster car seat icon
Booster Car Seat
material two tone style weighbridge icon
Weighbridge
material two tone style limousine icon
Limousine
material two tone style car freshener icon
Car Freshener
material two tone style car battery icon
Car Battery
material two tone style car headlights icon
Car Headlights
material two tone style cable car icon
Cable Car
material two tone style boot open icon
Boot Open
material two tone style traction control icon
Traction Control
material two tone style hill descent control icon
Hill Descent Control
material two tone style distance warning icon
Distance Warning
material two tone style toyota icon
Toyota
material two tone style people in car icon
People in Car
material two tone style windshield defroster and foot outlet icon
Windshield Defroster and Foot Outlet
material two tone style seat heater icon
Seat Heater
material two tone style parking assist icon
Parking Assist
material two tone style suspension dampers icon
Suspension Dampers
material two tone style smart icon
Smart
material two tone style fuel filter warning icon
Fuel Filter Warning
material two tone style fresh air icon
Fresh Air
material two tone style lease icon
Lease
material two tone style driving guidelines icon
Driving Guidelines
material two tone style car top view icon
Car Top View
material two tone style illumination brightness icon
Illumination Brightness
material two tone style panel and foot outlet icon
Panel and Foot Outlet
material two tone style rear window defogger icon
Rear Window Defogger
material two tone style catalytic converter warning icon
Catalytic Converter Warning
material two tone style key not in vehicle icon
Key Not in Vehicle
material two tone style ignition switch warning icon
Ignition Switch Warning
material two tone style roadside assistance icon
Roadside Assistance
material two tone style headlight icon
Headlight
material two tone style glow plug icon
Glow Plug
material two tone style jeep icon
Jeep
material two tone style mitsubishi icon
Mitsubishi
material two tone style air recirculation icon
Air Recirculation
material two tone style automatic gearbox warning icon
Automatic Gearbox Warning
material two tone style steering lock warning icon
Steering Lock Warning
Remove ad

Download 118 free Sunken car Icons in design styles.

Get free icons of Sunken car in style for your design. Our free images are pixel perfect and available in png and vector. Download icons in all formats or edit them for your designs.

You're also welcome to check new icons and popular icons.

newspaperpreviewmayacarvehicletransportationtransportautomobileautoautomotive